SNAI3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SNAI3 Polyclonal antibody (21350-1-AP)

• Featured Product
• KD/KO Validated

SNAI3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21350-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Zinc finger protein 293, Zfp293, SNAIL3, snail homolog 3 (Drosophila), SMUC

• 

  WB analysis of MCF-7 using 21350-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 21350-1-AP (SNAI3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of T-47D using 21350-1-AP

  T-47D cells were subjected to SDS PAGE followed by western blot with 21350-1-AP (SNAI3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 21350-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 21350-1-AP (SNAI3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 21350-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 21350-1-AP (SNAI3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 21350-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed MCF-7 cells using 21350-1-AP (SNAI3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SNAI3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, T-47D cells
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21350-1-AP targets SNAI3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15722

  Product name: Recombinant human SNAI3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-186 aa of BC107058

  Sequence: VKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWDRSSAVACISLPLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVLPTRWSPTLGPDRHGAPEKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCK

• Full Name: snail homolog 3 (Drosophila)
• Calculated Molecular Weight: 292 aa, 32 kDa
• Observed Molecular Weight: 32-38 kDa
• GenBank Accession Number: BC107058
• Gene Symbol: SNAI3
• Gene ID (NCBI): 333929
• RRID: AB_2878844
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3KNW1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SNAI3 Polyclonal antibody (catalog no. 21350-1-AP) has 5 total citations, all in human studies using WB (and IF). Citations appear in Biomedicines, Frontiers in Oncology, Translational Gastroenterology and Hepatology, Translational Andrology and Urology, and Growth Factors. Research fields include oral cancer ferroptosis, non-small-cell lung cancer transcription factors/immune infiltration, hepatocellular carcinoma signaling, renal cell carcinoma progression, and thyroid cancer EMT.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biomedicines; Inhibition of TPI1 Sensitizes Cisplatin-Resistant Oral Cancer to Ferroptosis; Authors - Dandan Wang
human	WB,IF	Front Oncol; Identifying key transcription factors and immune infiltration in non-small-cell lung cancer using weighted correlation network and Cox regression analyses; Authors - Jingyao Zhang ; KD Validated
human	WB	Transl Gastroenterol Hepatol; Ciprofol exerts anti-tumour effects in hepatocellular carcinoma through the Raf-MEK-ERK signalling pathway; Authors - Yining Chen
human	WB	Transl Androl Urol; RhoJ promotes the progression of clear cell renal cell carcinoma via the TNF-α/NF-κB axis.; Authors - Ji Feng
human	WB	Growth Factors; MiR-200c regulates invasion, proliferation and EMT of anaplastic thyroid cancer cells by targeting parathyroid hormone like hormone; Authors - Yan Zhang