SNAP91 Polyclonal antibody

• 

  WB analysis using 14093-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14093-1-AP (SNAP91 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 14093-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14093-1-AP (SNAP91 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 14093-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14093-1-AP (SNAP91 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 14093-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using SNAP91 antibody (14093-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SNAP91 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 14093-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

Phosphoprotein F1-20, KIAA0656, Clathrin coat-associated protein AP180, Clathrin coat assembly protein AP180, 91 kDa synaptosomal-associated protein

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below

Product Information

14093-1-AP targets SNAP91 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5224

  Product name: Recombinant human SNAP91 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 251-600 aa of BC060818

  Sequence: LKVAEAPSSLMETLEQHLNTLEGKKPGNKSGAPSPLSKSSPATTVTSPNSTPAKTIDTSPPVDLFATASAAVPVSTSKPSSDLLDLQPDFSSGGAAAAAAPAPPPPAGGATAWGGFGGSFMAPSPSPVTPAQNNLLQPNFEAAFGTTPSTSSSSSFDPSVFDGLGDLLMPTMAPAGQPAPVSMVPPSPAMAASKALGSDLDSSLASLVGNLGISGTTTKKGDLQWNAGEKKLTGGANWQPKVAPATWSAGVPPSAPLQGAVPPTSSVPPVAGAPSVGQPGAGFGMPPAGTGMPMMPQQPVMFAQPMMRPPFGAAAVPGTQLSPSPTPASQSPKKPPAKDPLADLNIKDFL

• Full Name: synaptosomal-associated protein, 91kDa homolog (mouse)
• Calculated Molecular Weight: 92.5 kDa
• Observed Molecular Weight: 160 kDa
• GenBank Accession Number: BC060818
• Gene Symbol: SNAP91
• Gene ID (NCBI): 9892
• RRID: AB_2923560
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60641
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNAP91, also known as AP180 or CALM, is a clathrin-coat assembly protein that sequesters clathrin. SNAP91/AP180 is required for clathrin-dependent endocytosis and SV reformation (PMID: 26903854; PMID: 31843760).The AP180 N-terminal homology (ANTH) domains is crucially involved in membrane budding processes, along with and Epsin N-terminal homology (ENTH) domains (PMID: 29774507).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB	Emerg Microbes Infect; CD1d facilitates African swine fever virus entry into the host cells via clathrin-mediated endocytosis; Authors - Xin Chen
Mouse	WB,IF	Mol Med Rep; miR‑153 promotes neural differentiation in the mouse hippocampal HT‑22 cell line and increases the expression of neuron‑specific enolase.; Authors - Chunli Xu