SNAPC1 Polyclonal antibody

• 

  IHC staining of human colon cancer using 11297-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 11297-1-AP (SNAPC1 antibody) at dilution of 1:50 (under 10x lens).

SNAPC1 Polyclonal Antibody for IHC, ELISA

Cat No. 11297-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

PTF subunit gamma, PTFgamma, SNAP43, SNAPc 43 kDa subunit, SNAPc subunit 1, SNAPC1

---

Product Information

11297-1-AP targets SNAPC1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1812

  Product name: Recombinant human SNAPC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 58-368 aa of BC019038

  Sequence: ALALAWRYFLPPYTFQIRVGALYLLYGLYNTQLCQPKQKIRVALKDWDEVLKFQQDLVNAQHFDAAYIFRKLRLDRAFHFTAMPKLLSYRMKKKIHRAEVTEEFKDPSDRVMKLITSDVLEEMLNVHDHYQNMKHVISVDKSKPDKALSLIKDDFFDNIKNIVLEHQQWHKDRKNPSLKSKTNDGEEKMEGNSQETERCERAESLAKIKSKAFSVVIQASKSRRHRQVKLDSSDSDSASGQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENESLSGTEFTASKKRRKH

• Full Name: small nuclear RNA activating complex, polypeptide 1, 43kDa
• Calculated Molecular Weight: 43 kDa
• GenBank Accession Number: BC019038
• Gene Symbol: SNAPC1
• Gene ID (NCBI): 6617
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16533
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.