SNAT2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SNAT2 Polyclonal antibody (25928-1-AP)

SNAT2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25928-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SLC38A2, ATA2, KIAA1382, PRO1068, Protein 40 9 1

• 

  WB analysis using 25928-1-AP

  37°C incubated and boiled mouse brain tissues were subjected to SDS PAGE followed by western blot with 25928-1-AP (SNAT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 25928-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25928-1-AP (SNAT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 25928-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 25928-1-AP (SNAT2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 25928-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 25928-1-AP (SNAT2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 25928-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 25928-1-AP (SNAT2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat pancreas using 25928-1-AP

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 25928-1-AP (SNAT2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 25928-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 25928-1-AP (SNAT2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 25928-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 25928-1-AP (SNAT2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse pancreas using 25928-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 25928-1-AP (SNAT2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse pancreas using 25928-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 25928-1-AP (SNAT2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HUVEC using 25928-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HUVEC cells using SNAT2 antibody (25928-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of A549 using 25928-1-AP

  1x10^6 A549 cells were intracellularly stained with 0.25 ug SNAT2 Polyclonal antibody (25928-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SNAT2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: 37°C incubated mouse brain tissue, HEK-293 cells
• Positive IHC detected in: mouse pancreas tissue, human cervical cancer tissue, human kidney tissue, rat pancreas tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HUVEC cells
• Positive FC (Intra) detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25928-1-AP targets SNAT2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23082

  Product name: Recombinant human SLC38A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-50 aa of BC040342

  Sequence: MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQN

• Full Name: solute carrier family 38, member 2
• Observed Molecular Weight: 45 kDa, 56 kDa
• GenBank Accession Number: BC040342
• Gene Symbol: SLC38A2
• Gene ID (NCBI): 54407
• RRID: AB_3085830
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96QD8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNAT2 (Sodium-dependent neutral amino acid transporter-2), the ubiquitous member of SLC38 family, accounts for the activity of transport system A for neutral amino acids in most mammalian tissues (PMID: 16734764). SNAT2 mediates uptake of neutral α-amino acids and are expressed in central neurons (PMID: 19240036). SNAT2 is expressed in breast cancer cell lines. SLC38A2 also acts as a selective target for inhibiting growth of Gln-dependent breast cancer cell lines (PMID: 33028955).

Publications

What published studies show

The SNAT2 Polyclonal antibody (Cat# 25928-1-AP) has 9 citations published in Molecular Cell, Cancer Letters, Animal Nutrition, Cell Reports, Journal of Agricultural and Food Chemistry, bioRxiv, and Nan Fang Yi Ke Da Xue Xue Bao. Research fields span antiviral innate immunity, hepatocellular carcinoma, glioblastoma radioresistance, lung cancer immune evasion, amino acid metabolism, piglet nutrition, fetal intestinal health, collagen synthesis, and placental amino acid transport.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Mol Cell; Asparagine sensing by TBK1 controls its phase separation to drive antiviral innate immune responses; Authors - Jie Du
		Cancer Lett; CircMFN2/miR-361-3p/ELK1 feedback loop promotes glutaminolysis and the progression of hepatocellular carcinoma; Authors - Xiaopei Hao
human	WB	Cancer Lett; PGK1/PHGDH axis drives radioresistance in glioblastoma stem cells.; Authors - Zhangchun Cheng
human	WB	Cancer Lett; HHLA2 promotes immune evasion in EGFR-mutant lung cancer by inhibiting CD8(+) T cell glutamine metabolism via KIR3DL3 interaction.; Authors - Fei Wu
pig	WB	Anim Nutr; Increased maternal valine intake in low-protein diets accelerates growth performance of suckling piglets by improving mammary gland-fetal intestinal metabolism.; Authors - Siyong Wei
		Cell Rep; An IGF2BP3-dependent metabolic circuit governs macrophage recruitment and immunosuppression in glioblastoma.; Authors - Weiwei Dai