Tested Applications
| Positive WB detected in | mouse brain tissue, mouse trachea tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13646-1-AP targets Syntaphilin in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4594 Product name: Recombinant human SNPH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 121-424 aa of BC035788 Sequence: WIEEECHRVEAQLALKEARKEIKQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETLLHSMEVAQNGMAKEDGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQPGDPSSGSAEDGADSGFAAADDTLSRTDALEASSLLSSGVDCGTEETSLHSSFGLGPRFPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRDPNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSYWSRH Predict reactive species |
| Full Name | syntaphilin |
| Calculated Molecular Weight | 538 aa, 58 kDa |
| Observed Molecular Weight | 70-75 kDa, 65 kDa |
| GenBank Accession Number | BC035788 |
| Gene Symbol | SNPH |
| Gene ID (NCBI) | 9751 |
| RRID | AB_2193555 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15079 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Syntaphilin is a protein selectively expressed in brain. Syntaphilin competes with SNAP-25 for binding to syntaxin-1 and inhibits SNARE complex formation by absorbing free syntaxin-1, and thereby regulates synaptic vesicle exocytosis (PMID: 10707983). The deduced 537-amino acid syntaphilin protein contains an N-terminal proline-rich domain, a predicted coiled-coil domain, a putative C-terminal transmembrane domain, and numerous consensus sites for protein phosphorylation. Whereas the calculated molecular mass of syntaphilin is 58 kDa, the apparent molecular mass of 70-75 kDa is larger than the predicted mass, suggesting a posttranslational modification of syntaphilin (PMID: 9205841; 10707983). An extra band of 65 kDa was also detected by this antibody that may represent an alternative syntaphilin gene product or a stable degradation product (PMID: 10707983; 24457644).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Syntaphilin antibody 13646-1-AP | Download protocol |
| WB protocol for Syntaphilin antibody 13646-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Syntaphilin polyclonal antibody (Cat# 13646-1-AP) has 10 citations published in journals including Bioactive Materials, Journal of Ethnopharmacology, Bioengineering & Translational Medicine, Neurochemistry International, Scientific Reports, Journal of Biological Chemistry, Molecular Brain, Neuroscience, Brain Research, and Frontiers in Genetics. Research fields span neural regeneration, ischemic stroke, spinal cord injury, ALS, neurogenesis, traumatic brain injury, mitochondrial trafficking, and intrahepatic cholangiocarcinoma.
| Species | Application | Title |
|---|---|---|
Bioact Mater Advanced nerve regeneration enabled by neural conformal electronic stimulators enhancing mitochondrial transport | ||
J Ethnopharmacol Buyang Huanwu decoction promotes neurological recovery after ischemic stroke by activating the Akt/PAK5/SNPH axis to enhance mitochondrial recruitment and axonal remodeling. | ||
Bioeng Transl Med Photobiomodulation augments the effects of mitochondrial transplantation in the treatment of spinal cord injury in rats by facilitating mitochondrial transfer to neurons via Connexin 36 | ||
Neurochem Int 3-Nitrotyrosine shortens axons of non-dopaminergic neurons by inhibiting mitochondrial motility | ||
Sci Rep Identification of a novel interaction of FUS and syntaphilin may explain synaptic and mitochondrial abnormalities caused by ALS mutations. | ||
J Biol Chem Bisphenol-A impairs hippocampal neurogenesis by disrupting Kinesin-1-dependent mitochondrial trafficking. |
