Syntaphilin Polyclonal antibody

• 

  WB analysis using 13646-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13646-1-AP (Syntaphilin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse trachea using 13646-1-AP

  mouse trachea tissue were subjected to SDS PAGE followed by western blot with 13646-1-AP (Syntaphilin antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 13646-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13646-1-AP (Syntaphilin antibody at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 13646-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13646-1-AP (Syntaphilin antibody at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Syntaphilin Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13646-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

KIAA0374, SNPH, syntaphilin

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse trachea tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

13646-1-AP targets Syntaphilin in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4594

  Product name: Recombinant human SNPH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 121-424 aa of BC035788

  Sequence: WIEEECHRVEAQLALKEARKEIKQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETLLHSMEVAQNGMAKEDGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQPGDPSSGSAEDGADSGFAAADDTLSRTDALEASSLLSSGVDCGTEETSLHSSFGLGPRFPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRDPNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSYWSRH

• Full Name: syntaphilin
• Calculated Molecular Weight: 538 aa, 58 kDa
• Observed Molecular Weight: 70-75 kDa, 65 kDa
• GenBank Accession Number: BC035788
• Gene Symbol: SNPH
• Gene ID (NCBI): 9751
• RRID: AB_2193555
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15079
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Syntaphilin is a protein selectively expressed in brain. Syntaphilin competes with SNAP-25 for binding to syntaxin-1 and inhibits SNARE complex formation by absorbing free syntaxin-1, and thereby regulates synaptic vesicle exocytosis (PMID: 10707983). The deduced 537-amino acid syntaphilin protein contains an N-terminal proline-rich domain, a predicted coiled-coil domain, a putative C-terminal transmembrane domain, and numerous consensus sites for protein phosphorylation. Whereas the calculated molecular mass of syntaphilin is 58 kDa, the apparent molecular mass of 70-75 kDa is larger than the predicted mass, suggesting a posttranslational modification of syntaphilin (PMID: 9205841; 10707983). An extra band of 65 kDa was also detected by this antibody that may represent an alternative syntaphilin gene product or a stable degradation product (PMID: 10707983; 24457644).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IF	Sci Rep; Identification of a novel interaction of FUS and syntaphilin may explain synaptic and mitochondrial abnormalities caused by ALS mutations.; Authors - Shaakir Salam
mouse	WB	Mol Brain; Disrupted-in-schizophrenia 1 (DISC1) and Syntaphilin collaborate to modulate axonal mitochondrial anchoring.; Authors - Cana Park
rat	WB	Brain Res; Miro1 provides neuroprotection via the mitochondrial trafficking pathway in a rat model of traumatic brain injury.; Authors - Chen Chen
rat	WB	Bioact Mater; Advanced nerve regeneration enabled by neural conformal electronic stimulators enhancing mitochondrial transport; Authors - Hao Bai
human	IHC	Front Genet; Systematic profiling of mitochondria-related transcriptome in tumorigenesis, prognosis, and tumor immune microenvironment of intrahepatic cholangiocarcinoma: a multi-center cohort study; Authors - Bo Chen
mouse	IHC	Neurochem Int; 3-Nitrotyrosine shortens axons of non-dopaminergic neurons by inhibiting mitochondrial motility; Authors - Masahiro Hirai