SNRNP27 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SNRNP27 Polyclonal antibody, PBS Only (20505-1-PBS)

• 

  WB analysis using 20505-1-AP (same clone as 20505-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20505-1-AP (SNRNP27 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20505-1-PBS in a different storage buffer formulation.

SNRNP27 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20505-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

27K, RY1, U4/U6.U5 27K, U4/U6.U5 snRNP 27 kDa protein

---

Product Information

20505-1-PBS targets SNRNP27 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14308

  Product name: Recombinant human SNRNP27 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 71-155 aa of BC017890

  Sequence: RDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLDFIA

• Full Name: small nuclear ribonucleoprotein 27kDa (U4/U6.U5)
• Calculated Molecular Weight: 155 aa, 19 kDa
• Observed Molecular Weight: 23-27 kDa
• GenBank Accession Number: BC017890
• Gene Symbol: SNRNP27
• Gene ID (NCBI): 11017
• RRID: AB_3741999
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WVK2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SNRNP27 also named U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein. It is located in the cell nucleus. SNRNP27 may play a role in mRNA splicing.