SNRNP35 Polyclonal antibody

• 

  WB analysis using 17698-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17698-1-AP (SNRNP35 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

SNRNP35 Polyclonal Antibody for WB, ELISA

Cat No. 17698-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

HM 1, HM1, Protein HM 1, SNRNP35, U11/U12 35K, U11/U12 snRNP 35 kDa protein, U1SNRNPBP

---

Tested Applications

• Positive WB detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17698-1-AP targets SNRNP35 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11954

  Product name: Recombinant human SNRNP35 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-246 aa of BC054034

  Sequence: MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERSRSRERHWDSRTRDRDHDRGREKRWQEREPTRVWPDNDWERERDFRDDRIKGREKKERGK

• Full Name: small nuclear ribonucleoprotein 35kDa (U11/U12)
• Calculated Molecular Weight: 246 aa, 29 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC054034
• Gene Symbol: SNRNP35
• Gene ID (NCBI): 11066
• RRID: AB_3085534
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16560
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNRNP35 is a homolog of the U1-snRNP binding protein. The N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, which is a characteristic of a variety of splicing factors.