SNRPB2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68095-1-Ig (same clone as 68095-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68095-1-Ig (SNRPB2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 68095-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 68095-1-Ig (same clone as 68095-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.8 ug SNRPB2 Monoclonal antibody (68095-1-Ig, Clone:1D11E9) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.8 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 68095-1-PBS in a different storage buffer formulation.

SNRPB2 Monoclonal Antibody for Indirect ELISA, WB

Cat No. 68095-1-PBS

Clone No.1D11E9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Indirect ELISA, WB

Synonyms

U2 snRNP B'', U2 snRNP B, U2 small nuclear ribonucleoprotein B'', 1D11E9

---

Product Information

68095-1-PBS targets SNRPB2 in Indirect ELISA, WB applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5540

  Product name: Recombinant human SNRPB2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-225 aa of BC036737

  Sequence: MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK

• Full Name: small nuclear ribonucleoprotein polypeptide B''
• Calculated Molecular Weight: 225 aa, 26, 5 kDa
• Observed Molecular Weight: 25-31 kDa
• GenBank Accession Number: BC036737
• Gene Symbol: SNRPB2
• Gene ID (NCBI): 6629
• RRID: AB_2918832
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P08579
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

U2 small nuclear ribonucleoprotein B''(SNRPB2) is part of the U2 RNP particle, which associated with the branch point of the lariat-shaped intron, in intermediate in the cascade of mRNA precursor splicing event. Only in presence of the U2A' protein, SNRPB2 binds stem loop IV of U2 snRNA.