SNRPG Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SNRPG Polyclonal antibody, PBS Only (15084-1-PBS)

• 

  WB analysis of Jurkat using 15084-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15084-1-AP (SNRPG antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15084-1-AP (same clone as 15084-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15084-1-AP (SNRPG antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15084-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 15084-1-AP (same clone as 15084-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 15084-1-AP (SNRPG Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15084-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15084-1-AP (same clone as 15084-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15084-1-AP (SNRPG Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15084-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 15084-1-AP (same clone as 15084-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 15084-1-AP (SNRPG Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15084-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15084-1-AP (same clone as 15084-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15084-1-AP (SNRPG Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15084-1-PBS in a different storage buffer formulation.

SNRPG Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15084-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

PBSCG, Sm G, Sm protein G, SMG, Sm-G

---

Product Information

15084-1-PBS targets SNRPG in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7163

  Product name: Recombinant human SNRPG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-76 aa of BC000070

  Sequence: MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

• Full Name: small nuclear ribonucleoprotein polypeptide G
• Calculated Molecular Weight: 8 kDa
• Observed Molecular Weight: 9 kDa
• GenBank Accession Number: BC000070
• Gene Symbol: SNRPG
• Gene ID (NCBI): 6637
• RRID: AB_2191789
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62308
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.