SNX1 Polyclonal antibody

• 

  WB analysis using 10304-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10304-1-AP (SNX1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 10304-1-AP

  IP result of anti-SNX1 (IP:10304-1-AP, 4ug; Detection:10304-1-AP 1:800) with HeLa cells lysate 2000ug.

• 

  IHC staining of human breast cancer using 10304-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10304-1-AP (SNX1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human breast cancer using 10304-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10304-1-AP (SNX1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human kidney using 10304-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10304-1-AP (SNX1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 10304-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10304-1-AP (SNX1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human pancreas cancer using 10304-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 10304-1-AP (SNX1 antibody) at dilution of 1:100 (under 25x lens).

• Featured Product
• KD/KO Validated

SNX1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 10304-1-AP

Publications(13)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ChIP, ELISA

Synonyms

HsT17379, SNX1, SNX1A, sorting nexin 1, Vps5

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, HepG2 cells, Jurkat cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human breast cancer tissue, human kidney tissue, human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 6 publications below
• WB: See 10 publications below
• IHC: See 1 publications below
• IF: See 3 publications below
• IP: See 2 publications below
• ChIP: See 1 publications below

Product Information

10304-1-AP targets SNX1 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0499

  Product name: Recombinant human SNX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 81-287 aa of BC000357

  Sequence: QDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQEDQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLSGAGLLKM

• Full Name: sorting nexin 1
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC000357
• Gene Symbol: SNX1
• Gene ID (NCBI): 6642
• RRID: AB_2192217
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13596
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sorting nexin 1 (SNX1, synonyms: SNX1A, MGC8664, HsT17379) is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This endosomal protein regulates the cell-surface expression of epidermal growth factor receptor. SNX1 also has a role in sorting protease-activated receptor-1 from early endosomes to lysosomes. This protein may form oligomeric complexes with family members.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Proc Natl Acad Sci U S A; Retromer dysfunction in amyotrophic lateral sclerosis.; Authors - Eduardo J Pérez-Torres
human	WB,IP	J Neurosci; A critical role for Sorting Nexin 1 in the trafficking of metabotropic glutamate receptors.; Authors - Rohan Sharma ; KD Validated
mouse	WB	FASEB J; Sorting nexin 1 loss results in increased oxidative stress and hypertension.; Authors - Jian Yang ; KO Validated
mouse	WB	J Biol Chem; PMID: 23152498; Authors - Villar Van Anthony M VA ; KD Validated
mouse	IF	Mol Biol Cell; Trafficking defects in WASH-knockout fibroblasts originate from collapsed endosomal and lysosomal networks.; Authors - Gomez Timothy S TS
mouse	IF	PLoS One; PMID: 25181483; Authors - Takeshi Yamasaki