SNX1 Recombinant monoclonal antibody

• 

  WB analysis using 86335-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86335-3-RR (SNX1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 86335-3-RR

  IP result of anti-SNX1 (IP:86335-3-RR, 4ug; Detection:86335-3-RR 1:2000) with HeLa cells lysate 1400 ug.

• 

  Affinity and Kinetic Characterization of 86335-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86335-3-RR against Human SNX1 were performed. The affinity constant is 0.921 nM.

SNX1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86335-3-RR

Clone No.251062D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Sorting nexin-1

---

Tested Applications

• Positive WB detected in: Jurkat cells, HEK-293T cells, HeLa cells, HepG2 cells, Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86335-3-RR targets SNX1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0499

  Product name: Recombinant human SNX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 82-287 aa of BC000357

  Sequence: DQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQEDQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLSGAGLLKM

• Full Name: sorting nexin 1
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC000357
• Gene Symbol: SNX1
• Gene ID (NCBI): 6642
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13596
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sorting nexin 1 (SNX1, synonyms: SNX1A, MGC8664, HsT17379) is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This endosomal protein regulates the cell-surface expression of epidermal growth factor receptor. SNX1 also has a role in sorting protease-activated receptor-1 from early endosomes to lysosomes. This protein may form oligomeric complexes with family members.