SNX11 Polyclonal antibody

• 

  WB analysis of HeLa using 14953-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14953-1-AP (SNX11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

SNX11 Polyclonal Antibody for WB, ELISA

Cat No. 14953-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

SNX11, sorting nexin 11

---

Tested Applications

• Positive WB detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14953-1-AP targets SNX11 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6791

  Product name: Recombinant human SNX11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-270 aa of BC000768

  Sequence: MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSPSPPPSEEKDHLEVWAPVVDSEVPSLESPTLPPLSSPLCCDFGRPKEGTSTLQSVRRAVGGDHAVPLDPGQLETVLEK

• Full Name: sorting nexin 11
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC000768
• Gene Symbol: SNX11
• Gene ID (NCBI): 29916
• RRID: AB_2878094
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5W9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNX11 belongs to the sorting nexin family of proteins which contain a phox (PX) domain. PX domain is a phosphoinositide binding domain. SNX family members are involved in intracellular trafficking. SNX11 protein lacks C-terminal coiled-coil motifs found in several other SNX family members.