SNX12 Polyclonal antibody

• 

  WB analysis using 12374-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12374-1-AP (SNX12 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 12374-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SNX12 antibody (12374-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

SNX12 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 12374-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Sorting nexin-12

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12374-1-AP targets SNX12 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3014

  Product name: Recombinant human SNX12 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-162 aa of BC020559

  Sequence: MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKSLA

• Full Name: sorting nexin 12
• Calculated Molecular Weight: 172 aa, 20 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC020559
• Gene Symbol: SNX12
• Gene ID (NCBI): 29934
• RRID: AB_3085392
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UMY4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNXs (sorting nexins) are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif-the PX domain (PMID:12461558). SNXs are involved in endocytosis and protein trafficking. SNX12 (Sorting nexin 12) is localized in early endosomes and SNX12 overexpression specifically prevents the degradative pathway from early to late endosomes/lysosomes (PMID: 22719997). SNX12 may participate in Alzheimer's disease (AD) pathology by regulating the endocytosis of BACE1 and affecting β-processing of APP (PMID: 22709416).