SNX16 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SNX16 Polyclonal antibody, PBS Only (13492-1-PBS)

• 

  WB analysis using 13492-1-AP (same clone as 13492-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13492-1-AP (SNX16 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13492-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 13492-1-AP (same clone as 13492-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 13492-1-AP (SNX16 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13492-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HT-29 using 13492-1-AP (same clone as 13492-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HT-29 cells using SNX16 antibody (13492-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 13492-1-PBS in a different storage buffer formulation.

SNX16 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 13492-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

13492-1-PBS targets SNX16 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4315

  Product name: Recombinant human SNX16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-344 aa of BC033630

  Sequence: MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSSPLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPEESLDVSETEGEQILKVESSALEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED

• Full Name: sorting nexin 16
• Calculated Molecular Weight: 344 aa, 39 kDa
• Observed Molecular Weight: 39-50 kDa
• GenBank Accession Number: BC033630
• Gene Symbol: SNX16
• Gene ID (NCBI): 64089
• RRID: AB_3085416
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57768
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SNX16,Sorting nexin 16, is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which mediates membrane association by interaction with phosphoinositides. SNX16 associates with late endosome membranes as is involved in tubule formation, cholesterol transport, and transport of tetraspanin CD81. It also inhibits cell migration and tumorigenesis. SNX16 directs the sorting of EGFR to the endosomal compartment and thus regulates EGF-induced cell signaling (PMID:15292396). It may function in the trafficking of proteins between the early and late endosomal compartments. SNX16 was detected 49-53 kDa in human (PMID:12813048).