SNX21 Polyclonal antibody

• 

  WB analysis of HepG2 using 22193-1-AP

  WB result of SNX21 (22193-1-AP, 1:500) with si-control and si-SNX21 transfected HepG2 cells.

• 

  IHC staining of human kidney using 22193-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 22193-1-AP (SNX21 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 22193-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 22193-1-AP (SNX21 Antibody) at dilution of 1:200 (under 40x lens).

• Featured Product
• KD/KO Validated

SNX21 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22193-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, IHC, ELISA

Synonyms

C20orf161, PP3993, SNX L, SNX21, SNXL, Sorting nexin 21, sorting nexin family member 21, Sorting nexin L

---

Tested Applications

• Positive WB detected in: HepG2
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

22193-1-AP targets SNX21 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16900

  Product name: Recombinant human SNX21 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC019823

  Sequence: MHRGTQEGAMASRLLHRLRHALAGDGPGEAAASPEAEQFPESSELEDDDAEGLSSRLSGTLSFTSAEDDEDDEDEDDEEAGPDQLPLGDGTSGEDAERSPPPDGQWGSQLLARQLQDFWKKSRNTLAPQRLLFEVTSANVVKDPPSKYVLYTLTVIGPGPPDCQPAQISRRYSDFERLHRNLQRQFRGPMAAISFPQSH

• Full Name: sorting nexin family member 21
• Calculated Molecular Weight: 373 aa, 41 kDa
• Observed Molecular Weight: ~40 kDa
• GenBank Accession Number: BC019823
• Gene Symbol: SNX21
• Gene ID (NCBI): 90203
• RRID: AB_2879022
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q969T3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNX21, also named as C20orf161 and SNXL, is a member of the sorting nexin family. It binds to membranes enriched in phosphatidylinositol 3-phosphate (PtdIns(P3)) and phosphatidylinositol 4,5-bisphosphate. It is involved in several stages of intracellular trafficking.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	J Cell Sci; Sorting nexin-21 is a scaffold for the endosomal recruitment of huntingtin.; Authors - Chris M Danson