SNX29 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SNX29 Recombinant monoclonal antibody (86446-1-RR)

• 

  WB analysis of HepG2 using 86446-1-RR

  HepG2 cells were subjected to SDS PAGE followed by western blot with 86446-1-RR (SNX29 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 86446-1-RR

  WB result of SNX29 antibody (86446-1-RR; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SNX29 transfected HepG2 cells.

• 

  IF Staining of HeLa using 86446-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SNX29 antibody (86446-1-RR, Clone: 251222A2 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 86446-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86446-1-RR against Human SNX29 were performed. The affinity constant is 11.7 nM.

• Featured Product
• KD/KO Validated

SNX29 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86446-1-RR

Clone No.251222A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

RUN domain-containing protein 2A, RUNDC2A, Sorting nexin-29

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86446-1-RR targets SNX29 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag32618

  Product name: Recombinant human SNX29 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of XM_011522738

  Sequence: MSGSQNNDKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFEAVLQHGLKRSRGLALTAAAIKQAAGFASKTETEPVFWYYVKEVLNKHELQRFYSLRHIASDVGRGRAWLRCALNEHSLERYLHMLLADRCRLSTFYEDWS

• Full Name: sorting nexin 29
• Calculated Molecular Weight: 91kd
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: XM_011522738
• Gene Symbol: SNX29
• Gene ID (NCBI): 92017
• RRID: AB_3744888
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TEQ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins classified by the presence of a phospholipid-binding motif PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX29 (Sorting nexin 29) is associated with bipolar disorder (BPD) and major depressive disorder (MDD) in the Han population (PMID: 33143498). The expression of SNX29 is significantly upregulated in most tumor tissues, and its expression is associated with the progression, immune infiltration and drug sensitivity of various cancers (PMID: 36829159).