SNX9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SNX9 Polyclonal antibody (15721-1-AP)

• Featured Product
• KD/KO Validated

SNX9 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15721-1-AP Copied!

Publications (23)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA, IB

Synonyms

SH3PX1, Protein SDP1, SDP1, SH3 and PX domain-containing protein 1, SH3 and PX domain-containing protein 3A

• 

  WB analysis using 15721-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15721-1-AP (SNX9 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 15721-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 15721-1-AP (SNX9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 15721-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15721-1-AP (SNX9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat heart using 15721-1-AP

  rat heart tissue were subjected to SDS PAGE followed by western blot with 15721-1-AP (SNX9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse heart using 15721-1-AP

  IP result of anti-SNX9 (IP:15721-1-AP, 4ug; Detection:15721-1-AP 1:8000) with mouse heart tissue lysate 1880 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 15721-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15721-1-AP (SNX9 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 15721-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 15721-1-AP (SNX9 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 15721-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15721-1-AP (SNX9 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 15721-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 15721-1-AP (SNX9 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 15721-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 15721-1-AP (SNX9 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 15721-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 15721-1-AP (SNX9 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 15721-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using SNX9 antibody (15721-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 15721-1-AP

  Immunofluorescent analysis of HeLa cells using 15721-1-AP (SNX9 antibody) at dilution of 1:50 and Rhodamine-Goat anti-Rabbit IgG.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SNX9 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, rat heart tissue, human heart tissue, mouse skeletal muscle tissue, mouse heart tissue
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: human stomach cancer tissue, mouse colon tissue, rat stomach tissue, human placenta tissue, mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15721-1-AP targets SNX9 in WB, IHC, IF/ICC, IP, ELISA, IB applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8440

  Product name: Recombinant human SNX9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-362 aa of BC005022

  Sequence: MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAHASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEW

• Full Name: sorting nexin 9
• Calculated Molecular Weight: 595 aa, 67 kDa
• Observed Molecular Weight: 78 kDa
• GenBank Accession Number: BC005022
• Gene Symbol: SNX9
• Gene ID (NCBI): 51429
• RRID: AB_2286415
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5X1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif-the PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX9 (Sorting nexin-9, also known as SH3PX1) was originally identified as a protein that interacted with the metalloproteinases ADAM9 and ADAM15. It contains a PX and an Sec homology 3 (SH3) domain. SNX9 functions in clathrin-mediated endocytosis and clathrin-independent, actin-dependent fluid-phase endocytosis (PMID: 17609109). On SDS-PAGE, SNX9 migrates at a molecular weight (70-78 kDa) higher than its calculated molecular mass of 67 kDa (PMID: 15299020; 12952949; 18411244; 15703209).

Publications

What published studies show

Anti-SNX9 (Catalog No. 15721-1-AP) has 23 total citations. Journals include Nature, Immunity, Cancer Discovery, Nature Communications, Molecular Cell, PNAS, Developmental Cell, Journal of Cell Biology, Structure, and others. Research fields span mitochondrial biology, innate immunity, anti-tumor immunity, endocytosis, lysosome function, GPCR signaling, brain development, viral replication, nanomedicine, p53 regulation, clathrin-mediated endocytosis, hair cell biology, and neurodegeneration.

Automatically generated from the 23 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; Fumarate induces vesicular release of mtDNA to drive innate immunity; Authors - Vincent Zecchini ; KD Validated
human	WB	Immunity; cis-B7:CD28 interactions at invaginated synaptic membranes provide CD28 co-stimulation and promote CD8+ T cell function and anti-tumor immunity; Authors - Yunlong Zhao
human	IF	Cancer Discov; In vivo role of INPP4B in tumor and metastasis suppression through regulation of PI3K/AKT signaling at endosomes.; Authors - Chen Li Chew
human	WB	Nat Commun; SNX8 enables lysosome reformation and reverses lysosomal storage disorder; Authors - Xinran Li
mouse	WB	Nat Commun; Selective packaging of mitochondrial proteins into extracellular vesicles prevents the release of mitochondrial DAMPs.; Authors - Kiran Todkar ; KD Validated
mouse	WB	Nat Commun; Membrane remodeling by FAM92A1 during brain development regulates neuronal morphology, synaptic function, and cognition; Authors - Liang Wang