SNX9 Monoclonal antibody, PBS Only

SNX9 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 68255-1-PBS
Clone No.1B11C9

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

MST155, MSTP155, Protein SDP1, SDP1, SH3PX1, SH3PXD3A, SNX9, sorting nexin 9, WISP

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68255-1-PBS targets SNX9 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8446

Product name: Recombinant human SNX9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-362 aa of BC005022

Sequence: MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAHASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEW

Predict reactive species
Full Name sorting nexin 9
Calculated Molecular Weight 595 aa, 67 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC005022
Gene Symbol SNX9
Gene ID (NCBI) 51429
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y5X1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif-the PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX9 (Sorting nexin-9, also known as SH3PX1) was originally identified as a protein that interacted with the metalloproteinases ADAM9 and ADAM15. It contains a PX and an Sec homology 3 (SH3) domain. SNX9 functions in clathrin-mediated endocytosis and clathrin-independent, actin-dependent fluid-phase endocytosis (PMID: 17609109). On SDS-PAGE, SNX9 migrates at a molecular weight (70-78 kDa) higher than its calculated molecular mass of 67 kDa (PMID: 15299020; 12952949; 18411244; 15703209).

Loading...
||
New chat Able
正在加载,请稍候...