SOAT1/ACAT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SOAT1/ACAT1 Polyclonal antibody, PBS Only (29369-1-PBS)

• 

  WB analysis using 29369-1-AP (same clone as 29369-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29369-1-AP (SOAT1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 29369-1-AP (same clone as 29369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 29369-1-AP (SOAT1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29369-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 29369-1-AP (same clone as 29369-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SOAT1 antibody (29369-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 29369-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 29369-1-AP (same clone as 29369-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SOAT1/ACAT1 antibody (29369-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 29369-1-PBS in a different storage buffer formulation.

SOAT1/ACAT1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 29369-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

SOAT1, ACACT, ACAT, ACAT-1, Acyl-coenzyme A:cholesterol acyltransferase 1

---

Product Information

29369-1-PBS targets SOAT1/ACAT1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30945

  Product name: Recombinant human SOAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-140 aa of BC028940

  Sequence: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRT

• Full Name: sterol O-acyltransferase 1
• Calculated Molecular Weight: 550 aa, 65 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC028940
• Gene Symbol: SOAT1/ACAT1
• Gene ID (NCBI): 6646
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35610
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SOAT1 (Sterol O-acyltransferase 1), also known as ACAT1 (Acyl-Coenzyme A: cholesterol acyltransferase 1), is a crucial endoplasmic reticulum-resident enzyme that plays a central role in cellular cholesterol homeostasis. Its primary function is to catalyze the esterification of free cholesterol with long-chain fatty acids, forming cholesteryl esters. This process serves two key purposes: it prevents the toxic buildup of free cholesterol in cellular membranes and creates neutral lipid droplets for cholesterol storage. SOAT1 is ubiquitously expressed, with high activity in the steroidogenic tissues, and macrophages. Due to its role in facilitating cholesterol ester accumulation in macrophages and its overexpression in various cancers, SOAT1 has emerged as a promising therapeutic target for the treatment of atherosclerosis, neurodegenerative diseases, and cancer.