SOCS3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85155-4-RR (same clone as 85155-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85155-4-RR (SOCS3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85155-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85155-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85155-4-RR against Human SOCS3 were performed. The affinity constant is below 1 pM.

SOCS3 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85155-4-PBS

Clone No.242809D7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

242809D7, ATOD4, CIS3, CIS-3, Cytokine-inducible SH2 protein 3

---

Product Information

85155-4-PBS targets SOCS3 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5170

  Product name: Recombinant human SOCS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC060858

  Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

• Full Name: suppressor of cytokine signaling 3
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC060858
• Gene Symbol: SOCS3
• Gene ID (NCBI): 9021
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14543
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The suppressor of cytokine signaling (SOCS) family proteins are negative feedback system that inhibits cytokine signal transduction. One of the SOCS family, SOCS3, also named CIS3 and SSI3, is involved in inhibition of JAK/STAT pathway which regulates IL-6 signaling in vivo. SOCS3 can be rapidly trigger by a number of factors including interleukins, IFN-gamma and TNF-alpha. Pathology such as inflammatory response, wound repair and obesity and so on have been linked to SOCS3. Observed MW of SOCS3 is from 22-30 kDa(PMID: 24827536,PMID: 26260587, PMID: 26797799).