Tested Applications
| Positive WB detected in | mouse liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27191-1-AP targets SOCS4 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25887 Product name: Recombinant human SOCS4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC060790 Sequence: MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPS Predict reactive species |
| Full Name | suppressor of cytokine signaling 4 |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 51 kDa |
| GenBank Accession Number | BC060790 |
| Gene Symbol | SOCS4 |
| Gene ID (NCBI) | 122809 |
| RRID | AB_3669587 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8WXH5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SOCS4 contains a SH2 domain and a SOCS BOX domain, and belongs to Suppressors of cytokine signaling (SOCS) family. SOCS family members are known to be cytokine-inducible negative regulators of cytokine signaling.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SOCS4 antibody 27191-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

