SOCS6 Polyclonal antibody

SOCS6 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 27343-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

CIS 4, CIS4, CIS-4, Cytokine-inducible SH2 protein 4, HSPC060

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, Calu-1 cells, NIH/3T3 cells, human placenta tissue
Positive IP detected inNIH/3T3 cells, human placenta tissue
Positive IHC detected inhuman colon tissue, mouse colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27343-1-AP targets SOCS6 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25594

Product name: Recombinant human SOCS6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 132-385 aa of BC020082

Sequence: YSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSPRAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWY

Predict reactive species
Full Name suppressor of cytokine signaling 6
Calculated Molecular Weight 60 kDa
Observed Molecular Weight 60-75 kDa
GenBank Accession NumberBC020082
Gene Symbol SOCS6
Gene ID (NCBI) 9306
RRIDAB_3669595
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14544
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SOCS6 (Suppressor of cytokine signaling 6) is also named as CIS4 and SOCS4. SOCS6 is one of eight members of the SOCS family of proteins. SOCS6 is involved in negative regulation of receptor signaling by increasing degradation mediated by ubiquitination of receptors or substrate proteins and induces apoptosis by targeting mitochondrial proteins (PMID: 25172101). SOCS6 is widely expressed in many tissues and is found to be downregulated in many cancers including colorectal cancer, gastric cancer, lung cancer, ovarian cancer, stomach cancer, thyroid cancer, hepatocellular carcinoma, and pancreatic cancer (PMID: 25172101). In addition to its molecular weight of 60 kDa, SOCS6 has a 70 kDa isoform (PMID: 34169835, PMID: 22125600).

Protocols

Product Specific Protocols
IHC protocol for SOCS6 antibody 27343-1-APDownload protocol
IP protocol for SOCS6 antibody 27343-1-APDownload protocol
WB protocol for SOCS6 antibody 27343-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...