SON Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SON Polyclonal antibody, PBS Only (28046-1-PBS)

• 

  IHC staining of mouse colon using 28046-1-AP (same clone as 28046-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 28046-1-AP (SON antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28046-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 28046-1-AP (same clone as 28046-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 28046-1-AP (SON antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28046-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 28046-1-AP (same clone as 28046-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 28046-1-AP (SON antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28046-1-PBS in a different storage buffer formulation.

SON Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 28046-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

28046-1-PBS targets SON in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27620

  Product name: Recombinant human SON protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 14-182 aa of NM_001291411

  Sequence: MVSKFREIQQELSSGRNEGQLNGETNTPIEGNQAGDAAASARSLPNEEIVQKIEEVLSGVLDTELRYKPDLKEGSRKSRCVSVQTDPTDEIPTKKSKKHKKHKNKKKKKKKEKEKKYKRQPEESESKTKSHDDGNIDLESDSFLKFDSEPSAVALELPTRAFGPSETNES

• Full Name: SON DNA binding protein
• Calculated Molecular Weight: 264 aa
• GenBank Accession Number: NM_001291411
• Gene Symbol: SON
• Gene ID (NCBI): 6651
• RRID: AB_3086024
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P18583
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SON, also called C21orf50 and DBP5, is a nuclear speckle-localized protein that shares homology with pre-mRNA splicing accessory factors (PMID: 10950926). It is an RNA-binding protein that acts as an mRNA splicing cofactor by promoting efficient splicing of transcripts that possess weak splice sites, and specifically promotes splicing of many cell-cycle and DNA-repair transcripts that possess weak splice sites, such as TUBG1, KATNB1, TUBGCP2, AURKB, PCNT, AKT1, RAD23A, and FANCG (PMID: 20581448; 21504830).