SORCS3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SORCS3 Polyclonal antibody (32248-1-AP)

• 

  WB analysis using 32248-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32248-1-AP (SORCS3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

SORCS3 Polyclonal Antibody for WB, ELISA

Cat No. 32248-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

KIAA1059, VPS10 domain-containing receptor SorCS3

---

Tested Applications

• Positive WB detected in: SK-N-SH cells, IMR-32 cells. SH-SY5Y cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32248-1-AP targets SORCS3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37710

  Product name: Recombinant human SORCS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 34-190 aa of NM_014978.2

  Sequence: EITWDATGGPGRPAAPASRPPALSPLSPRAVASQWPEELASARRAAVLGRRAGPELLPQQGGGRGGEMQVEAGGTSPAGERRGRGIPAPAKLGGARRSRRAQPPITQERGDAWATAPADGSRGSRPLAKGSREEVKAPRAGGSAAEDLRLPSTSFAL

• Full Name: sortilin-related VPS10 domain containing receptor 3
• Calculated Molecular Weight: 136kDa，1222aa
• Observed Molecular Weight: 160 kDa
• GenBank Accession Number: NM_014978.2
• Gene Symbol: SORCS3
• Gene ID (NCBI): 22986
• RRID: AB_3742552
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UPU3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sortilin related VPS10 domain-containing receptor 3 (SorCS3) belongs to the vacuolar protein sorting 10 protein (VPS10p) receptor family. SorCS3 is a specific receptor for nerve growth factor (NGF) that regulates NGF signal transduction across membranes, and SorCS3 is mainly expressed in the hippocampus and cortex of the brain (PMID: 35393432).