SOX10 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Cytometric bead array sample test of MP02850-1

  The mean SOX10 concentration was determined to be 129.3 ng/mL in SH-SY5Y cell extract based on a 1.2 mg/mL extract load, 41.3 ng/mL in A549 cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02850-1

  Cytometric bead array standard curve of MP02850-1, SOX10 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87051-2-PBS. Detection antibody: 87051-1-PBS. Standard: Ag38090. Range: 0.781-100 ng/mL.

SOX10 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 87051-2-PBS

Clone No.252024C7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

DOM, PCWH, SRY-box transcription factor 9, Transcription factor SOX 10, Transcription factor SOX-10

---

Product Information

87051-2-PBS targets SOX10 as part of a matched antibody pair:

MP02850-1: 87051-2-PBS capture and 87051-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag38090

  Product name: Recombinant human SOX10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 267-466 aa of BC002824

  Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP

• Full Name: SRY (sex determining region Y)-box 10
• Calculated Molecular Weight: 50 kDa
• GenBank Accession Number: BC002824
• Gene Symbol: SOX10
• Gene ID (NCBI): 6663
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P56693
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.