SOX10 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SOX10 Recombinant monoclonal antibody (87051-3-RR)

SOX10 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 87051-3-RR

Clone No.252024E10

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

DOM, PCWH, SRY-box transcription factor 9, Transcription factor SOX 10, Transcription factor SOX-10

• 

  WB analysis using 87051-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87051-3-RR (SOX10 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. Negative control: SW480 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 87051-3-RR

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 87051-3-RR (SOX10 antibody) at dilution of 1:4000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 87051-3-RR

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 87051-3-RR (SOX10 antibody) at dilution of 1:4000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human malignant melanoma using 87051-3-RR

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 87051-3-RR (SOX10 antibody) at dilution of 1:4000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human malignant melanoma using 87051-3-RR

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 87051-3-RR (SOX10 antibody) at dilution of 1:4000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pituitary adenoma using 87051-3-RR

  Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 87051-3-RR (SOX10 antibody) at dilution of 1:4000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 87051-3-RR

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 87051-3-RR (SOX10 antibody) at dilution of 1:4000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast using 87051-3-RR

  Immunohistochemical analysis of paraffin-embedded human breast tissue slide using 87051-3-RR (SOX10 antibody) at dilution of 1:4000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colorectal cancer using 87051-3-RR

  Immunohistochemical analysis of paraffin-embedded human colorectal cancer tissue slide using 87051-3-RR (SOX10 antibody) at dilution of 1:4000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 87051-3-RR

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 87051-3-RR (SOX10 antibody) at dilution of 1:4000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A375 using 87051-3-RR

  Immunofluorescent analysis of (4% PFA) fixed A375 cells using SOX10 antibody (87051-3-RR, Clone: 252024E10 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 87051-3-RR

  Biolayer interferometry (BLl) kinetic assays of 87051-3-RR against Human SOX10 were performed. The affinity constant is 66.0 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: MDA-MB-453 cells, A375 cells, C6 cells
• Positive IHC detected in: human breast tissue, human colorectal cancer tissue, human skin cancer tissue, human malignant melanoma tissue, human pituitary adenoma tissue, human appendicitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87051-3-RR targets SOX10 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag38090

  Product name: Recombinant human SOX10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 267-466 aa of BC002824

  Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP

• Full Name: SRY (sex determining region Y)-box 10
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50-65 kDa
• GenBank Accession Number: BC002824
• Gene Symbol: SOX10
• Gene ID (NCBI): 6663
• RRID: AB_3745302
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P56693
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-65 kDa. (PMID: 23799842, 39982575)