SOX13 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SOX13 Polyclonal antibody (18902-1-AP)

• Featured Product
• KD/KO Validated

SOX13 Polyclonal Antibody for WB, IP, ELISA

Cat No. 18902-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, chIP, ELISA

Synonyms

Transcription factor SOX-13, SRY, Sox 13, Sex determining region Y, ICA12

• 

  WB analysis using 18902-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18902-1-AP (SOX13 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NCI-H1299 using 18902-1-AP

  NCI-H1299 cells were subjected to SDS PAGE followed by western blot with 18902-1-AP (SOX13 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of BGC-823 using 18902-1-AP

  BGC-823 cells were subjected to SDS PAGE followed by western blot with 18902-1-AP (SOX13 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of SH-SY5Y using 18902-1-AP

  IP result of anti-SOX13 (IP:18902-1-AP, 4ug; Detection:18902-1-AP 1:500) with SH-SY5Y cells lysate 1200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SOX13 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: BGC-823 cells, NCI-H1299 cells
• Positive IP detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18902-1-AP targets SOX13 in WB, IHC, IF, IP, chIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13537

  Product name: Recombinant human SOX13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-301 aa of BC106038

  Sequence: MSMRSPISAQLALDGVGTMVNCTIKSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFRGSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDVKGTQESLAEKELQLLVMIHQLSTLRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQHKINLLQQQIQQVNMPYVMIPAFPPSHQPLPVTPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRPGAMATHHPLQEPSQPLNLTAKPKA

• Full Name: SRY (sex determining region Y)-box 13
• Calculated Molecular Weight: 622 aa, 69 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC106038
• Gene Symbol: SOX13
• Gene ID (NCBI): 9580
• RRID: AB_10642149
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UN79
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SRY-BOX 13(SOX13), identified a sequence homologous more than 60% to the SRY HMG box ,with a centrally located HMG box and an N-terminal leucine zipper motif with a neighboring glutamine stretch called a Q box. SOX13 binds to the consensus HMG-box motif. It's an IDDM-specific human autoantigen, and a gamma-delta-specific gene in the immune system. It can modulates Wnt/TCF activity. This is a rabbit polyclonal raised against part of N-terminal chain of SOX13 of human origin.

Publications

What published studies show

The SOX13 antibody (Cat# 18902-1-AP) has 6 total citations. These appear in journals including J Exp Clin Cancer Res, Brain, Mol Cell Biochem, Lab Invest, Front Cardiovasc Med, and Bioengineered. Research fields span glioma angiogenesis, neural progenitor development, testicular development, hepatocellular carcinoma metastasis, endothelial inflammation, and breast cancer proliferation/glycolysis. Applications include WB, IHC, IF, and ChIP in human and mouse samples.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,chIP	J Exp Clin Cancer Res; FUS/circ_002136/miR-138-5p/SOX13 feedback loop regulates angiogenesis in Glioma.; Authors - Zhenwei He
human	WB,IHC	Brain; POU3F2 regulates canonical Wnt signalling via SOX13 and ADNP to expand the neural progenitor population; Authors - Courtney R Benoit
mouse	WB, IF	Mol Cell Biochem; Expressions of Sox9, Sox5, and Sox13 transcription factors in mice testis during postnatal development.; Authors - Mikella Daigle
human	WB,IHC	Lab Invest; Sox13 promotes hepatocellular carcinoma metastasis by transcriptionally activating Twist1.; Authors - Min Feng ; KD Validated
human	WB,IF	Front Cardiovasc Med; Sox13 is a novel flow-sensitive transcription factor that prevents inflammation by repressing chemokine expression in endothelial cells; Authors - Catherine Demos ; KD Validated
human	WB,IHC	Bioengineered; Sex-determining Region Y-box transcription factor 13 promotes breast cancer cell proliferation and glycolysis by activating the tripartite motif containing 11-mediated Wnt/β-catenin signaling pathway.; Authors - Xiaoyan Jin ; KD Validated