SOX14 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SOX14 Polyclonal antibody (30613-1-AP)

• 

  WB analysis using 30613-1-AP

  Mouse brain tissue were subjected to SDS PAGE followed by western blot with 30613-1-AP (SOX14 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

SOX14 Polyclonal Antibody for WB, ELISA

Cat No. 30613-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

SOX28

---

Tested Applications

• Positive WB detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30613-1-AP targets SOX14 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31127

  Product name: Recombinant human SOX14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 85-155 aa of BC106730

  Sequence: NLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEV

• Full Name: SRY (sex determining region Y)-box 14
• Calculated Molecular Weight: 240 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC106730
• Gene Symbol: SOX14
• Gene ID (NCBI): 8403
• RRID: AB_3742359
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95416
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SOX14, also known as SOX28, is a member of the SOX (SRY-related HMG-box) family of transcription factors. This intronless gene encodes a protein that acts as a transcriptional regulator after forming complexes with other proteins. It is involved in embryonic development and cell fate determination. SOX14 is primarily expressed in the nervous system, where it plays a role in neuronal differentiation and circuit formation. Mutations in SOX14 are suggested to be responsible for limb defects associated with conditions such as blepharophimosis, ptosis, epicanthus inversus syndrome (BPES), and Moebius syndrome. Additionally, SOX14 has been implicated in tumor development, with studies indicating its involvement in cervical cancer through mechanisms such as the p53 and Wnt/β-catenin pathways. (PMID: 34098886, PMID: 34181293)