SOX2 Recombinant monoclonal antibody

Proteintech has an extensive range of SOX2 antibodies validated forWB, IHC, IF/ICC, IF-P, FC (Intra), CoIP, ELISA and more.
Cat No. 83059-5-RR
Clone No.230225G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, ELISA

Transcription factor SOX 2, SOX 2, MCOPS3, MCOPS 3, ANOP3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU-251 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:150-1:600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83059-5-RR targets SOX2 in IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0612

Product name: Recombinant human SOX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 59-118 aa of BC013923

Sequence: MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT

Predict reactive species
Full Name SRY (sex determining region Y)-box 2
Calculated Molecular Weight 34 kDa
GenBank Accession NumberBC013923
Gene Symbol SOX2
Gene ID (NCBI) 6657
RRIDAB_3670787
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP48431
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sox2, also known as SRY (sex determining region Y)-box 2, is a transcription factor essential for maintaining self-renewal of undifferentiated ES cells and is one of the key transcription factors used to reprogram mouse and human fibroblasts to a pluripotent state. Sox2 expressed in undifferentiated pluripotent stem cells and germ cells during development. Affinity purified rabbit anti-Sox2 antibody can be used to demonstrate pluripotency of ES and iPS cells. This antibody is a rabbit polyclonal antibody raised against an internal region of human SOX2. a rare undiferentiated cell population that is intermingled with the Bergmann glia of the adult murine cerebellar cortex, expresses the stem cell markers Sox2 and Nestin, and lacks markers of glial or neuronal diferentiation. Sox2-expressing neural stem cells in the subgranular zone (SGZ) , a well-known stem cell niche of the adult brain.

Protocols

Product Specific Protocols
IF protocol for SOX2 antibody 83059-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...