CoraLite® Plus 488-conjugated SOX2 Recombinant monoclonal antibody

Proteintech has an extensive range of SOX2 antibodies validated forWB, IHC, IF/ICC, IF-P, FC (Intra), CoIP, ELISA and more.
Cat No. CL488-83059-5
Clone No.230225G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Transcription factor SOX 2, SOX 2, MCOPS3, MCOPS 3, ANOP3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-83059-5 targets SOX2 in applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0612

Product name: Recombinant human SOX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 59-118 aa of BC013923

Sequence: MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT

Predict reactive species
Full Name SRY (sex determining region Y)-box 2
Calculated Molecular Weight 34 kDa
GenBank Accession NumberBC013923
Gene Symbol SOX2
Gene ID (NCBI) 6657
RRIDAB_3673178
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP48431
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Sox2, also known as SRY (sex determining region Y)-box 2, is a transcription factor essential for maintaining self-renewal of undifferentiated ES cells and is one of the key transcription factors used to reprogram mouse and human fibroblasts to a pluripotent state. Sox2 expressed in undifferentiated pluripotent stem cells and germ cells during development. Affinity purified rabbit anti-Sox2 antibody can be used to demonstrate pluripotency of ES and iPS cells. This antibody is a rabbit polyclonal antibody raised against an internal region of human SOX2. a rare undiferentiated cell population that is intermingled with the Bergmann glia of the adult murine cerebellar cortex, expresses the stem cell markers Sox2 and Nestin, and lacks markers of glial or neuronal diferentiation. Sox2-expressing neural stem cells in the subgranular zone (SGZ) , a well-known stem cell niche of the adult brain.

Loading...
||
New chat Able
正在加载,请稍候...