SOX8 Recombinant monoclonal antibody

• 

  Affinity and Kinetic Characterization of 83238-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83238-2-RR against Human SOX8 were performed. The affinity constant is 6.54 nM.

SOX8 Uni-rAb^® Recombinant Antibody for ELISA

Cat No. 83238-2-RR

Clone No.240120H5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

Transcription factor SOX-8, Transcription factor SOX 8, 240120H5

---

Product Information

83238-2-RR targets SOX8 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34395

  Product name: Recombinant human SOX8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 298-446 aa of BC031797

  Sequence: EPGQAYGGAYFHAGASPVWAHKSAPSASASPTETGPPRPHIKTEQPSPGHYGDQPRGSPDYGSCSGQSSATPAAPAGPFAGSQGDYGDLQASSYYGAYPGYAPGLYQYPCFHSPRRPYASPLLNGLALPPAHSPTSHWDQPVYTTLTRP

• Full Name: SRY (sex determining region Y)-box 8
• Calculated Molecular Weight: 446 aa, 47 kDa
• GenBank Accession Number: BC031797
• Gene Symbol: SOX8
• Gene ID (NCBI): 30812
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P57073
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.