SOX9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SOX9 Polyclonal antibody (27526-1-AP)

SOX9 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27526-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

CMD1, CMPD1, SRA1, Transcription factor SOX 9, Transcription factor SOX-9

• 

  WB analysis using 27526-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27526-1-AP (SOX9 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 27526-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27526-1-AP (SOX9 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A549 cells, COLO 320 cells, Caco-2 cells, Calu-1 cells, HepG2 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27526-1-AP targets SOX9 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26274

  Product name: Recombinant human SOX9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 306-405 aa of NM_000346

  Sequence: MVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPS

• Full Name: SRY (sex determining region Y)-box 9
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56 kDa, 68-75 kDa
• GenBank Accession Number: NM_000346
• Gene Symbol: SOX9
• Gene ID (NCBI): 6662
• RRID: AB_3742237
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48436
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SOX9, also named as Transcription factor SOX-9, is a 509 amino acid protein. Sex-determining region Y (SRY)-box 9 protein (SOX9) is a member of the SOX family of transcription factors (TFs) which are developmental regulators that possess high mobility group (HMG) box DNA binding and transactivation domains. It participates in a variety of functions, such as lineage restriction and terminal diferentiation, through precise temporal and spatial expression patterns that difer between particular cell types and tissues. SOX9 gene has been implicated in different types of cancer as an oncogene; however, it also may behave as a tumor suppressor. SOX9 can be ubiquitinated or SUMOylated to higher molecular weight (PMID: 24155239; 16307912; 16554309; 32070068)

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Biochem Pharmacol; SIS3 attenuates traumatic heterotopic ossification by targeting TGF-β2-driven endothelial-mesenchymal transition.; Authors - Dong Mao
rat	WB	Front Pharmacol; Oleanolic acid cubic liquid crystal nanoparticle-based thermosensitive gel attenuates knee osteoarthritis symptoms in rats.; Authors - Zhiqi Shi