Tested Applications
| Positive WB detected in | Jurkat cells, NIH/3T3 cells, HEK-293 cells, HeLa cells |
| Positive IHC detected in | human lung cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human colon cancer tissue |
| Positive IF/ICC detected in | HEK-293 cells |
| Positive FC (Intra) detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:175-1:700 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66508-1-Ig targets SP1 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16720 Product name: Recombinant human SP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 437-785 aa of BC062539 Sequence: NLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF Predict reactive species |
| Full Name | Sp1 transcription factor |
| Calculated Molecular Weight | 785 aa, 81 kDa |
| Observed Molecular Weight | 95-105 kDa, 60-65 kDa |
| GenBank Accession Number | BC062539 |
| Gene Symbol | SP1 |
| Gene ID (NCBI) | 6667 |
| ENSEMBL Gene ID | ENSG00000185591 |
| RRID | AB_2881871 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P08047 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The transcription factor Sp1 is a C2H2 zinc-finger protein that is involved in the regulation of a wide variety of genes, including housekeeping genes and tumor-developing genes. It is associated with tumor development, growth, and metastasis [PMID: 16209919]. It regulates the expression of a large number of genes involved in a variety of processes such as cell growth, apoptosis, differentiation and immune responses. Besides, it has a role in modulating the cellular response to DNA damage, recruiting SMARCA4/BRG1 on the c-FOS promoter, regulation of FE65 gene expression [PMID:11371615,16332679]. SP1 has some isoforms with MW ~95-106 kDa and ~60 kDa [PMID:17462816].
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SP1 antibody 66508-1-Ig | Download protocol |
| IF protocol for SP1 antibody 66508-1-Ig | Download protocol |
| IHC protocol for SP1 antibody 66508-1-Ig | Download protocol |
| WB protocol for SP1 antibody 66508-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SP1 Monoclonal antibody (4G3H3), catalog number 66508-1-Ig, has 9 citations published in journals including Br J Pharmacol, EMBO Rep, Acta Biochim Biophys Sin, Endocrinology, Genomics, Placenta, Evid Based Complement Alternat Med, Front Mol Biosci, and Chin Med. Research fields span neuropathic pain, bone cancer pain, endothelial injury, ovarian endometriosis, lung adenocarcinoma, placental function, mucus hypersecretion, cuproptosis, and diabetic kidney injury.
| Species | Application | Title |
|---|---|---|
Br J Pharmacol Sarco/endoplasmic reticulum Ca 2+ -ATPase 2b mediates oxidation-induced endoplasmic reticulum stress to regulate neuropathic pain | ||
EMBO Rep Histone modifications and Sp1 promote GPR160 expression in bone cancer pain within rodent models | ||
Acta Biochim Biophys Sin (Shanghai) Propofol protects against high glucose-mediated endothelial injury via inhibition of COX2 and iNOS expressions | ||
Endocrinology AURKA enhances the glycolysis and development of ovarian endometriosis through ERβ | ||
Genomics STRIP2 is regulated by the transcription factor Sp1 and promotes lung adenocarcinoma progression via activating the PI3K/AKT/mTOR/MYC signaling pathway | ||
Placenta Gestational TCBPA exposure impairs placental function and fetal Development: Mechanisms of syncytialization disruption and fetal growth restriction |
