CoraLite®594-conjugated SP1 Monoclonal antibody

SP1 Monoclonal Antibody for IF/ICC, IF-P, FC (Intra)
Cat No. CL594-66508
Clone No.4G3H3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, IF-P, FC (Intra)

TSFP1, Specificity protein 1, Sp1 transcription factor, SP 1, 4G3H3

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman colon cancer tissue
Positive IF/ICC detected inHEK-293 cells, human colon cancer tissue
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66508 targets SP1 in IF/ICC, IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16720

Product name: Recombinant human SP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 437-785 aa of BC062539

Sequence: NLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF

Predict reactive species
Full Name Sp1 transcription factor
Calculated Molecular Weight 785 aa, 81 kDa
Observed Molecular Weight 95-105 kDa, 60-65 kDa
GenBank Accession NumberBC062539
Gene Symbol SP1
Gene ID (NCBI) 6667
ENSEMBL Gene IDENSG00000185591
RRIDAB_3084714
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08047
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The transcription factor Sp1 is a C2H2 zinc-finger protein that is involved in the regulation of a wide variety of genes, including housekeeping genes and tumor-developing genes. It is associated with tumor development, growth, and metastasis [PMID: 16209919]. It regulates the expression of a large number of genes involved in a variety of processes such as cell growth, apoptosis, differentiation and immune responses. Besides, it has a role in modulating the cellular response to DNA damage, recruiting SMARCA4/BRG1 on the c-FOS promoter, regulation of FE65 gene expression [PMID:11371615,16332679]. SP1 has some isoforms with MW ~95-106 kDa and ~60 kDa [PMID:17462816].

Protocols

Product Specific Protocols
IF protocol for CL594 SP1 antibody CL594-66508Download protocol
FC protocol for CL594 SP1 antibody CL594-66508Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...