SP1 Monoclonal antibody, PBS Only

• 

  WB analysis using 66508-1-Ig (same clone as 66508-1-PBS)

  Various cells were subjected to SDS PAGE followed by western blot with 66508-1-Ig (SP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66508-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66508-1-Ig (same clone as 66508-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66508-1-Ig (SP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66508-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66508-1-Ig (same clone as 66508-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66508-1-Ig (SP1 antibody) at dilution of 1:350 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66508-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66508-1-Ig (same clone as 66508-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66508-1-Ig (SP1 antibody) at dilution of 1:350 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66508-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66508-1-Ig (same clone as 66508-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66508-1-Ig (SP1 antibody) at dilution of 1:350 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66508-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66508-1-Ig (same clone as 66508-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66508-1-Ig (SP1 antibody) at dilution of 1:350 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66508-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human colon cancer using 66508-1-Ig (same clone as 66508-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using SP1 antibody (66508-1-Ig, Clone: 4G3H3 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66508-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 66508-1-Ig (same clone as 66508-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using SP1 antibody (66508-1-Ig, Clone: 4G3H3 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66508-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293 using 66508-1-Ig (same clone as 66508-1-PBS)

  1X10^6 HEK-293 cells were intracellularly stained with 0.4 ug Anti-Human SP1 (66508-1-Ig, Clone:4G3H3) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66508-1-PBS in a different storage buffer formulation.

SP1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 66508-1-PBS

Clone No.4G3H3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Synonyms

4G3H3, SP 1, Sp1 transcription factor, Specificity protein 1, TSFP1

---

Product Information

66508-1-PBS targets SP1 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16720

  Product name: Recombinant human SP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 437-785 aa of BC062539

  Sequence: NLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF

• Full Name: Sp1 transcription factor
• Calculated Molecular Weight: 785 aa, 81 kDa
• Observed Molecular Weight: 95-105 kDa, 60-65 kDa
• GenBank Accession Number: BC062539
• Gene Symbol: SP1
• Gene ID (NCBI): 6667
• ENSEMBL Gene ID: ENSG00000185591
• RRID: AB_2881871
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P08047
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The transcription factor Sp1 is a C2H2 zinc-finger protein that is involved in the regulation of a wide variety of genes, including housekeeping genes and tumor-developing genes. It is associated with tumor development, growth, and metastasis [PMID: 16209919]. It regulates the expression of a large number of genes involved in a variety of processes such as cell growth, apoptosis, differentiation and immune responses. Besides, it has a role in modulating the cellular response to DNA damage, recruiting SMARCA4/BRG1 on the c-FOS promoter, regulation of FE65 gene expression [PMID:11371615,16332679]. SP1 has some isoforms with MW ~95-106 kDa and ~60 kDa [PMID:17462816].