SP100 Polyclonal antibody

• 

  WB analysis using 31102-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31102-1-AP (SP100 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SP100 Polyclonal Antibody for WB, ELISA

Cat No. 31102-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

DKFZp686E07254, FLJ00340, FLJ34579, Lysp100b, Nuclear autoantigen Sp 100, SP100, SP100 nuclear antigen, Speckled 100 kDa

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31102-1-AP targets SP100 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35193

  Product name: Recombinant human SP100 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 141-300 aa of BC011562

  Sequence: YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK

• Full Name: SP100 nuclear antigen
• Calculated Molecular Weight: 879 aa, 100 kDa
• Observed Molecular Weight: 75-85 kDa
• GenBank Accession Number: BC011562
• Gene Symbol: SP100
• Gene ID (NCBI): 6672
• RRID: AB_3669856
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P23497
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SP100 nuclear antigen, belongs to the nuclear bodies(NBs), has a role in the control of gene expression. It contains a HSR domain, which is important for the nuclear body targeting as well as for the dimerization, and one PxVxL motif, which if required for interaction with chromoshadow domains.