SP100 Recombinant monoclonal antibody, PBS Only

• 

SP100 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 84012-2-PBS

Clone No.241153D11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

Nuclear autoantigen Sp-100, Nuclear dot-associated Sp100 protein, SP 100, SP100 nuclear antigen, Speckled 100 kDa

---

Product Information

84012-2-PBS targets SP100 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35193

  Product name: Recombinant human SP100 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 141-300 aa of BC011562

  Sequence: YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK

• Full Name: SP100 nuclear antigen
• Calculated Molecular Weight: 879 aa, 100 kDa
• GenBank Accession Number: BC011562
• Gene Symbol: SP100
• Gene ID (NCBI): 6672
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23497
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.