SP100 Recombinant monoclonal antibody, PBS Only

SP100 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 84012-4-PBS
Clone No.241153F3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

241153F3, Nuclear autoantigen Sp-100, Nuclear dot-associated Sp100 protein, SP 100, SP100 nuclear antigen

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84012-4-PBS targets SP100 in WB, Cytometric bead array, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35193

Product name: Recombinant human SP100 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 141-300 aa of BC011562

Sequence: YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK

Predict reactive species
Full Name SP100 nuclear antigen
Calculated Molecular Weight 879 aa, 100 kDa
Observed Molecular Weight70-100 kDa
GenBank Accession NumberBC011562
Gene Symbol SP100
Gene ID (NCBI) 6672
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP23497
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SP100 nuclear antigen, belongs to the nuclear bodies(NBs), has a role in the control of gene expression. It contains a HSR domain, which is important for the nuclear body targeting as well as for the dimerization, and one PxVxL motif, which if required for interaction with chromoshadow domains. Sp100 is an acidic protein that exerts a highly aberrant electrophoretic mobility in SDS-polyacrylamide gel electrophoresis.

Loading...
||
New chat Able
正在加载,请稍候...