SP100 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84012-4-RR (same clone as 84012-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84012-4-RR (SP100 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84012-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84012-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84012-4-RR against Human SP100 were performed. The affinity constant is 0.127 nM.

SP100 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 84012-4-PBS

Clone No.241153F3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

241153F3, Nuclear autoantigen Sp-100, Nuclear dot-associated Sp100 protein, SP 100, SP100 nuclear antigen

---

Product Information

84012-4-PBS targets SP100 in WB, Cytometric bead array, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35193

  Product name: Recombinant human SP100 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 141-300 aa of BC011562

  Sequence: YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK

• Full Name: SP100 nuclear antigen
• Calculated Molecular Weight: 879 aa, 100 kDa
• Observed Molecular Weight: 70-100 kDa
• GenBank Accession Number: BC011562
• Gene Symbol: SP100
• Gene ID (NCBI): 6672
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23497
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SP100 nuclear antigen, belongs to the nuclear bodies(NBs), has a role in the control of gene expression. It contains a HSR domain, which is important for the nuclear body targeting as well as for the dimerization, and one PxVxL motif, which if required for interaction with chromoshadow domains. Sp100 is an acidic protein that exerts a highly aberrant electrophoretic mobility in SDS-polyacrylamide gel electrophoresis.