SP110 Polyclonal antibody

• 

  WB analysis of HeLa using 11502-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11502-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 11502-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 11502-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse small intestine using 11502-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 11502-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 11502-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse spleen using 11502-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 11502-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 11502-1-AP

  IP result of anti-SP110 (IP:11502-1-AP, 4ug; Detection:11502-1-AP 1:800) with HeLa cells lysate 4000ug.

• 

  FC experiment of Jurkat using 11502-1-AP

  1X10^6 Jurkat cells were intracellularly stained with 0.2 ug Anti-Human SP110 (11502-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

SP110 Polyclonal Antibody for WB, FC (Intra), IP, ELISA

Cat No. 11502-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), IP, ELISA, IF

Synonyms

Speckled 110 kDa, SP110 nuclear body protein, IPR1, Interferon-induced protein 41/75, IFI75

---

Tested Applications

• Positive WB detected in: A2780 cells, PC-3 cells, human brain tissue, Jurkat cells, K-562 cells, human testis tissue, HeLa cells, COLO 320 cells.
• Positive IP detected in: HeLa cells
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below
• FC: See 1 publications below

Product Information

11502-1-AP targets SP110 in WB, FC (Intra), IP, ELISA, IF applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2042

  Product name: Recombinant human SP110 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC019059

  Sequence: MFTMTRAMEEALFQHFMHQKLGIAYAIHKPFPFFEGLLDNSIITKRMYMESLEACRNLIPVSRVVHNILTQLERTFNLSLLVTLFSQINLREYPNLVTIYRSFKRVGASYERQSRDTPILLEAPTGLAEGSSLHTPLALPPPQPPQPSCSPCAPRVSEPGTSSQQSDEILSESPSPSDPVLPLPALIQEGRSTSVTNDKLTSKMNAEEDSEEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPEEPQEVSSTPSDKKGKKRKRCIWSTPKRRHKKKSLPRALSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEII

• Full Name: SP110 nuclear body protein
• Calculated Molecular Weight: 689 aa, 79 kDa
• Observed Molecular Weight: 62-66 kDa
• GenBank Accession Number: BC019059
• Gene Symbol: SP110
• Gene ID (NCBI): 3431
• RRID: AB_10863116
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HB58
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF,FC	J Clin Immunol; Detection of Sp110 by Flow Cytometry and Application to Screening Patients for Veno-occlusive Disease with Immunodeficiency.; Authors - Florian A Marquardsen