SP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SP2 Polyclonal antibody (25000-1-AP)

SP2 Polyclonal Antibody for WB, ELISA

Cat No. 25000-1-AP Copied!

Publications (3)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

KIAA0048, SP2, Sp2 transcription factor, Transcription factor Sp2

• 

  WB analysis of K-562 using 25000-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 25000-1-AP (SP2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 25000-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25000-1-AP (SP2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of C6 using 25000-1-AP

  C6 cells were subjected to SDS PAGE followed by western blot with 25000-1-AP (SP2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 25000-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25000-1-AP (SP2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SP2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HEK-293 cells, K-562 cells, C6 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25000-1-AP targets SP2 in WB, IHC, IF, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8060

  Product name: Recombinant human SP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 303-606 aa of BC016680

  Sequence: QQQVVQIPQQALRVVQAASATLPTVPQKPSQNFQIQAAEPTPTQVYIRTPSGEVQTVLVQDSPPATAAATSNTTCSSPASRAPHLSGTSKKHSAAILRKERPLPKIAPAGSIISLNAAQLAAAAQAMQTININGVQVQGVPVTITNTGGQQQLTVQNVSGNNLTISGLSPTQIQLQMEQALAGETQPGEKRRRMACTCPNCKDGEKRSGEQGKKKHVCHIPDCGKTFRKTSLLRAHVRLHTGERPFVCNWFFCGKRFTRSDELQRHARTHTGDKRFECAQCQKRFMRSDHLTKHYKTHLVTKNL

• Full Name: Sp2 transcription factor
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: BC016680
• Gene Symbol: SP2
• Gene ID (NCBI): 6668
• RRID: AB_2879839
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02086
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SP2 also named as Sp2 transcription factor or KIAA0048 is a 613 amino acid protein, which contains 3 C2H2-type zinc fingers and belongs to the sp1 C2H2-type zinc finger protein family. SP2 binds to box promoters elements and selectively activates mRNA synthesis from genes that contain functional recognition sites in nucleus . SP2 may regulate expression of the T-cell antigen receptor (TCR) gene.

Publications

What published studies show

The SP2 Polyclonal Antibody (Cat# 25000-1-AP) has 3 citations. They appear in Molecular Cell, Advanced Science, and Communications Biology. The research spans transcription factor isoform regulation, NFS1/IDH2-mediated attenuation of abdominal aortic aneurysms via SP2 interaction, and ST3Gal1-driven anti-tumour immunity in prostate cancer. Applications cited include WB, IF, and IHC in human and mouse samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Widespread variation in molecular interactions and regulatory properties among transcription factor isoforms.; Authors - Luke Lambourne
human,mouse	WB,IF	Adv Sci (Weinh); NFS1 Regulates IDH2 to Attenuate Abdominal Aortic Aneurysms via Interacting With SP2.; Authors - Luzheng Zhang
human	IHC	Commun Biol; ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (ST3Gal1) synthesis of Siglec ligands mediates anti-tumour immunity in prostate cancer; Authors - Rebecca Garnham

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

The single review for this product rates it 4 out of 5 stars. The reviewer used it for Western Blot on adult mouse cardiomyocytes at a 1:500 dilution. Overall the antibody performed well, though the reviewer noted the presence of some unspecific bands in the results.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Anh (Verified Customer) (07-15-2021)

have some unspecific bands

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: adult mouse cardiomyocytes

SP2 Antibody Western Blot validation (1:500 dilution) in adult mouse cardiomyocytes (Cat no:25000-1-AP)