SP6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SP6 Polyclonal antibody, PBS Only (21234-1-PBS)

• 

  WB analysis of fetal human brain using 21234-1-AP (same clone as 21234-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 21234-1-AP (KLF14 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21234-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 21234-1-AP (same clone as 21234-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21234-1-AP (KLF14 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21234-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 21234-1-AP (same clone as 21234-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 21234-1-AP (KLF14 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 21234-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 21234-1-AP (same clone as 21234-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 21234-1-AP (KLF14 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 21234-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 21234-1-AP (same clone as 21234-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 21234-1-AP (KLF14 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 21234-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 21234-1-AP (same clone as 21234-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 21234-1-AP (KLF14 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 21234-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Caco-2 using 21234-1-AP (same clone as 21234-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Caco-2 cells using SP6 antibody (21234-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21234-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SP6 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21234-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

AI1K, EPFN, EPIPROFIN, KLF14, Krueppel-like factor 14

---

Product Information

21234-1-PBS targets SP6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15707

  Product name: Recombinant human SP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-235 aa of BC103951

  Sequence: MLTAVCGSLGSQHTEAPHASPPRLDLQPLQTYQGHTSPEAGDYPSPLQPGELQSLPLGPEVDFSQGYELPGASSRVTCEDLESDSPLAPGPFSKLLQPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPHTQGALTSPGHPGALQAGLGGYVGDHQLCAPPPHPHAHHLLPAAGGQHLLGPPDGAKALEVAAPESQGLDSSLDGAARPKGSRRSVPRSSGQTVCRCPNCLE

• Full Name: Sp6 transcription factor
• Calculated Molecular Weight: 376 aa, 40 kDa
• GenBank Accession Number: BC103951
• Gene Symbol: SP6
• Gene ID (NCBI): 80320
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3SY56
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SP6 (chromosome 17) is a 376 amino acid protein, which localizes in nucleus. SP6 is a transcription factor of the SP/KLF family and an indispensable regulator of the morphological dynamics of ameloblast differentiation during tooth development. The levels of sp6 protein expressed in various tissues in the embryo. This antibody detects the SP6 protein. It can't detect the KLF14/BTEB5.

This antibody was previously listed as a KLF14 antibody, because the SP6 gene on chromosome 17q21.32 has been referred to as KLF14 in the literature. SP6 should not be confused with the KLF14 gene on chromosome 7q32.2.