SP6 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

SP6 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 84088-4-PBS
Clone No.241169E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

AI1K, EPFN, EPIPROFIN, KLF14, Krueppel-like factor 14

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84088-4-PBS targets SP6 as part of a matched antibody pair:

MP01005-1: 84088-1-PBS capture and 84088-4-PBS detection (validated in Cytometric bead array)

MP01005-2: 84088-4-PBS capture and 84088-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29372

Product name: Recombinant human SP6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 186-376 aa of BC103951

Sequence: PDGAKALEVAAPESQGLDSSLDGAARPKGSRRSVPRSSGQTVCRCPNCLEAERLGAPCGPDGGKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSGDRPFVCNWLFCGKRFTRSDELQRHLQTHTGTKKFPCAVCSRVFMRSDHLAKHMKTHEGAKEEAAGAASGEGKAGGAVEPPGGKGKREAEGSVAPSN

Predict reactive species
Full Name Sp6 transcription factor
Calculated Molecular Weight 376 aa, 40 kDa
GenBank Accession NumberBC103951
Gene Symbol SP6
Gene ID (NCBI) 80320
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ3SY56
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...