SP7 Polyclonal antibody

• 

  WB analysis using 28694-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28694-1-AP (SP7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SP7 Polyclonal Antibody for WB, ELISA

Cat No. 28694-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

osterix, OSX, Sp7 transcription factor, Transcription factor Sp7, Zinc finger protein osterix

---

Tested Applications

• Positive WB detected in: Saos-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

28694-1-AP targets SP7 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29889

  Product name: Recombinant human SP7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-179 aa of NM_152860

  Sequence: MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSVGSDLSASKTMGDAYPAPFTSTNGLLSPAGSPPAPTSGYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQ

• Full Name: Sp7 transcription factor
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: NM_152860
• Gene Symbol: SP7
• Gene ID (NCBI): 121340
• RRID: AB_3669667
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TDD2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sp7 is identified in several tissues, including bone, tooth, brain, and the reproductive tract (PMID: 11792318, 33135214, 36881265). In bone, Sp7 is expressed at multiple stages throughout the mesenchymal bone lineage and plays different roles in different osteocytes (PMID: 36881265). SP7 regulates osteoblast differentiation and bone formation through osteoblast target genes by recognizing AT-rich region. In osteocytes, SP7 regulates osteocyte maturation and intracortical remodeling through osteocyte target genes by recognizing TGA(G/T) TCA motif. SP7 also regulates chondrocyte differentiation and endochondral ossification (36881265).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Int J Biol Macromol; Cranial repair-promoting effect of oxidised sodium alginate/amino gelatine injectable hydrogel loaded with deer antler blood peptides; Authors - Taojing Yu
mouse	IF	J Inflamm Res; Vertebral Osteoporosis in Systemic Lupus Erythematosus: A Possible Involvement of Inflammation-Related Osteoblast Ferroptosis; Authors - Zhaobai Lao
human	IHC	Sci Rep; FoxA1 knockdown promotes BMSC osteogenesis in part by activating the ERK1/2 signaling pathway and preventing ovariectomy-induced bone loss; Authors - Lijun Li
mouse	WB	Biomed J; Autophagy-induced osteoblast-derived exosomes maintain bone formation and prevent osteoporosis by remodeling gut microbiota-metabolism; Authors - Lin Chen