SPACA3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SPACA3 Polyclonal antibody (21137-1-AP)

SPACA3 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 21137-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

ALLP17, Cancer/testis antigen 54, CT54, LYC3, Lysozyme like protein 3

• 

  WB analysis of HEK-293 using 21137-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21137-1-AP (SPACA3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 21137-1-AP

  Mouse testis tissues were subjected to SDS PAGE followed by western blot with 21137-1-AP (SPACA3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 21137-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 21137-1-AP (SPACA3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 21137-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21137-1-AP (SPACA3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 21137-1-AP

  Immunofluorescent analysis of HEK-293 cells using 21137-1-AP (SPACA3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse testis tissue, HEK-293 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21137-1-AP targets SPACA3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15589

  Product name: Recombinant human SPACA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-123 aa of BC029867

  Sequence: PYAGVCLAYFTSGFNAAALDYEADGSTNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF

• Full Name: sperm acrosome associated 3
• Calculated Molecular Weight: 215 aa, 23 kDa
• Observed Molecular Weight: 16 kDa, 28-32 kDa, 46-50 kDa
• GenBank Accession Number: BC029867
• Gene Symbol: SPACA3
• Gene ID (NCBI): 124912
• RRID: AB_10913810
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IXA5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPACA3, also named as LYC3, LYZL3, SLLP1, SPRASA, CT54 and ALLP-17, belongs to the glycosyl hydrolase 22 family. It is a sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. It could be a potential receptor for the egg oligosaccharide residue N-acetylglucosamine, which is present in the extracellular matrix over the egg plasma membrane. SPACA3 has a Dimer form(PMID:15982649 ).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Adv Sci (Weinh); EIF5A Couples Translational Control With Transcriptional Reprogramming Through Chromocenter Reorganization During Spermiogenesis.; Authors - Yuling Cai