SPAG5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84809-4-RR (same clone as 84809-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84809-4-RR (SPAG5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84809-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84809-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84809-4-RR against Human SPAG5 were performed. The affinity constant is below 1 pM.

SPAG5 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84809-4-PBS

Clone No.242374H6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Mitotic spindle-associated protein p126, MAP126, hMAP126, Deepest, Astrin

---

Product Information

84809-4-PBS targets SPAG5 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6485

  Product name: Recombinant human SPAG5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 844-1193 aa of BC000322

  Sequence: TVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQETLLLSTACPPTQEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSLQPAETPGMEESLAEMSIMTTELQSLCSLLQESKEEAIRTLQRKICELQARLQAQEEQHQEVQKAKEADIEKLNQALCLRYKNEKELQEVIQQQNEKILEQIDKSGELISLREEVTHLTRSLRRAETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLEFLS

• Full Name: sperm associated antigen 5
• Calculated Molecular Weight: 134 kDa
• Observed Molecular Weight: 135 kDa, 150 kDa
• GenBank Accession Number: BC000322
• Gene Symbol: SPAG5
• Gene ID (NCBI): 10615
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q96R06
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SPAG5, also named as MAP126, Astrin and Deepest, is necessary for normal spindle formation during mitosis. It is highly expressed in testis. SPAG5 has different localization in somatic versus male germ cells suggesting the possibility of different function. This antibody is specific to SPAG5.