SPAG6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SPAG6 Polyclonal antibody (12462-1-AP)

SPAG6 Polyclonal Antibody for WB, IP, ELISA

Cat No. 12462-1-AP Copied!

Publications (18)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

pf16, Protein PF16 homolog, Repro SA 1, SPAG6, sperm associated antigen 6, Sperm flagellar protein

• 

  WB analysis of mouse testis using 12462-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12462-1-AP (SPAG6 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 12462-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 12462-1-AP (SPAG6 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 12462-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12462-1-AP (SPAG6 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 12462-1-AP

  IP result of anti-SPAG6 (IP:12462-1-AP, 3ug; Detection:12462-1-AP 1:300) with mouse testis tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SPAG6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue, Jurkat cells, PC-3 cells
• Positive IP detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12462-1-AP targets SPAG6 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3130

  Product name: Recombinant human SPAG6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 109-458 aa of BC030585

  Sequence: AVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKGIAASALSDIVKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAKHTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPEDHIKAAAAWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTESSEDLQVKSKKAIKNILQKCTYLPALEPFLYDAPPNILKHVVGQFSKVLFPWIFRYTSAEGGQLSTT

• Full Name: sperm associated antigen 6
• Calculated Molecular Weight: 458 aa, 50 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC030585
• Gene Symbol: SPAG6
• Gene ID (NCBI): 9576
• RRID: AB_2194798
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75602
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sperm-associated antigen 6 (SPAG6) is an axonemal protein ubiquitously expressed in tissues containing ciliated cells. SPAG6 is essential for sperm motility and fertility. As a novel cancer-testis antigen, SPAG6 is overexpressed in myeloid malignancies. Recently, SPAG6 has been found to negatively regulate neuronal migration during mouse brain development.

Publications

What published studies show

SPAG6 Polyclonal antibody (Cat# 12462-1-AP) has 18 citations published across 11 journals, including EBioMedicine, Asian J Androl, iScience, Front Pharmacol, J Assist Reprod Genet, Zool Res, Clin Genet, and others. The associated research fields primarily cover male infertility and sperm flagellar morphological abnormalities (MMAF), primary ciliary dyskinesia, acute myeloid leukemia, neuronal migration in brain development, and environmental toxicology.

Automatically generated from the 18 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	EBioMedicine; CFAP70 is a solid and valuable target for the genetic diagnosis of oligo-astheno-teratozoospermia in infertile men; Authors - Hui-Juan Jin
human	WB	Ecotoxicol Environ Saf; Microcystin leucine arginine induces human sperm damage: Involvement of the Ca2+/CaMKKβ/AMPK pathway; Authors - Xing Guo
human	IF	Front Endocrinol (Lausanne); Novel Loss-of-Function Mutations in DNAH1 Displayed Different Phenotypic Spectrum in Humans and Mice.; Authors - Ranjha Khan
mouse	IF	Zool Res; CCDC181 is required for sperm flagellum biogenesis and male fertility in mice; Authors - Xiang-Jun Zhang
human	WB,IHC	Front Pharmacol; SPAG6 overexpression decreases the pro-apoptotic effect of daunorubicin in acute myeloid leukemia cells through the ROS/JNK MAPK axis in a GSTP1-dependent manner; Authors - Jie Luo
mouse	WB	iScience; Syncytin-a deficiency compromises murine sperm function by suppressing PRL/PGE2 and PI3K/AKT/mTOR pathway.; Authors - Qianqian Wang