SPANXC Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPANXC Polyclonal antibody, PBS Only (11957-1-PBS)

• 

  WB analysis of human testis using 11957-1-AP (same clone as 11957-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 11957-1-AP (SPANXC antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11957-1-PBS in a different storage buffer formulation.

SPANXC Polyclonal Antibody for WB, Indirect ELISA

Cat No. 11957-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

11957-1-PBS targets SPANXC in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2561

  Product name: Recombinant human SPANXC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-97 aa of BC054023

  Sequence: MDKQSSAGGVKRSVPCESNEVNETMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSPEELLNDHARENRINPLQMEEEEFMEIMVEIPAK

• Full Name: SPANX family, member C
• Calculated Molecular Weight: 97 aa, 11 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC054023
• Gene Symbol: SPANXC
• Gene ID (NCBI): 64663
• RRID: AB_10664922
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NY87
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.