SPARC Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SPARC Polyclonal antibody (33940-1-AP)

SPARC Polyclonal Antibody for WB, ELISA

Cat No. 33940-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Basement membrane protein 40, Basement-membrane protein 40, BM 40, BM-40, ON

• 

  WB analysis using 33940-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33940-1-AP (SPARC antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A375 cells, SK-MEL-30 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33940-1-AP targets SPARC in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg1169

  Product name: Recombinant Human SPARC protein (His Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-10*His

  Domain: 18-303 aa of NM_003118.4

  Sequence: APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

• Full Name: secreted protein, acidic, cysteine-rich (osteonectin)
• Calculated Molecular Weight: 35kDa
• Observed Molecular Weight: 35-43 kDa
• GenBank Accession Number: NM_003118.4
• Gene Symbol: SPARC
• Gene ID (NCBI): 6678
• RRID: AB_3743118
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09486
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPARC, also known as ON (Osteonectin) or BM-40 (Basement-membrane protein 40), is an extracellular glycoprotein with the calculated molecular mass of 35 kDa and the apparent molecular mass of 40-43 kDa and 50 kDa (PMID: 7495300, 12365801). SPARC belongs to a group of matricellular proteins defined as secreted components that do not contribute directly to the formation of structural elements but serve to modulate cell-matrix interactions and cellular functions (PMID: 7542656; 12231357). SPARC is expressed at high levels in bone tissue, is distributed widely in many other tissues and cell types, and is associated generally with tissues undergoing morphogenesis, remodeling and wound repair (PMID: 10567433). It elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (PMID: 12721366). Altered expression of SPARC has been reported in a variety of cancers, which include breast, ovarian, colorectal, and pancreatic cancer as well as melanoma and glioblastomas (PMID: 18849185).