SPAST Monoclonal antibody, PBS Only

SPAST Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 67361-1-PBS
Clone No.1F5A7

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

ADPSP, FSP2, KIAA1083, SPAST, Spastic paraplegia 4 protein, spastin, SPG4

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67361-1-PBS targets SPAST in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18866

Product name: Recombinant human SPAST protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 79-278 aa of BC150260

Sequence: CQRFSRALMAAKRSSGAAPAPASASAPAPVPGGEAERVRVFHKQAFEYISIALRIDEDEKAGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLLESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTPTTATRK

Predict reactive species
Full Name spastin
Calculated Molecular Weight 616 aa, 67 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC150260
Gene Symbol SPAST
Gene ID (NCBI) 6683
RRIDAB_2882613
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UBP0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SPAST encodes a microtubule-severing protein called spastin. By severing microtubules into small segments, SPAST participates in the regeneration of neurites. Mutations in the SPAST gene (previously known as SPG4) are the most common causes of hereditary spastic paraplegia (HSP-SPG4). Mammalian cells express at least two spastin isoforms, a less-abundant full-length form (M1-spastin, 68 kDa) and a more highly expressed isoform (M87-spastin, 60 kDa) that lacks the N-terminal 86 amino acids of the full-length protein. Also, there are two additional 64 kDa and 55 kDa isoforms due to alternative splicing of SPG4 exon 4. This antibody recognizes all these isoforms of spastin.

Loading...
||
New chat Able
正在加载,请稍候...