SPATA1 Polyclonal antibody

SPATA1 Polyclonal Antibody for WB, ELISA
Cat No. 24980-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

SP 2, SPAP1, SPATA1, Sperm specific protein SP 2, spermatogenesis associated 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman testis tissue, mouse testis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24980-1-AP targets SPATA1 in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21784

Product name: Recombinant human SPATA1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-284 aa of BC127634

Sequence: MKKDKKRNKIPIDNYPIQTLVNMSLNPSRPSSSELVELHVFYVPEGSWNYKLNTISTEVVNKFISAGFLRVSPQLTLRALRERLGEFLGEDAIAEKFLFLKCIGNNLAVVKEKQESELKLKSFAPPYALQPELYLLPVMDHLGNVYSPSTVILDERQTNNGVNEADGTIHRPISVTLFKEELGRDPSLLENTLKELPNKNQEEAGGKATAEKSQIAKNQIGNSELPGSLEDSNNDCFGTKKSVFGKMKMIQLSVEDRTIRQLKKSTSPYQITLHFLVNLFFLQE

Predict reactive species
Full Name spermatogenesis associated 1
Calculated Molecular Weight 437 aa, 50 kDa
Observed Molecular Weight 40-50 kDa
GenBank Accession NumberBC127634
Gene Symbol SPATA1
Gene ID (NCBI) 64173
RRIDAB_2879830
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ5VX52
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
WB protocol for SPATA1 antibody 24980-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...