SPATA1 Polyclonal antibody

• 

  WB analysis of human testis using 24980-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 24980-1-AP (SPATA1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 24980-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24980-1-AP (SPATA1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 24980-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 24980-1-AP (SPATA1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

SPATA1 Polyclonal Antibody for WB, ELISA

Cat No. 24980-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

SP 2, SPAP1, SPATA1, Sperm specific protein SP 2, spermatogenesis associated 1

---

Tested Applications

• Positive WB detected in: human testis tissue, mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24980-1-AP targets SPATA1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21784

  Product name: Recombinant human SPATA1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-284 aa of BC127634

  Sequence: MKKDKKRNKIPIDNYPIQTLVNMSLNPSRPSSSELVELHVFYVPEGSWNYKLNTISTEVVNKFISAGFLRVSPQLTLRALRERLGEFLGEDAIAEKFLFLKCIGNNLAVVKEKQESELKLKSFAPPYALQPELYLLPVMDHLGNVYSPSTVILDERQTNNGVNEADGTIHRPISVTLFKEELGRDPSLLENTLKELPNKNQEEAGGKATAEKSQIAKNQIGNSELPGSLEDSNNDCFGTKKSVFGKMKMIQLSVEDRTIRQLKKSTSPYQITLHFLVNLFFLQE

• Full Name: spermatogenesis associated 1
• Calculated Molecular Weight: 437 aa, 50 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC127634
• Gene Symbol: SPATA1
• Gene ID (NCBI): 64173
• RRID: AB_2879830
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VX52
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.